PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta013179
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family S1Fa-like
Protein Properties Length: 90aa    MW: 9870.72 Da    PI: 10.4384
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-27749PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA122.91.1e-382690670
       S1FA  6 veakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
               +  kG+nPGlivllvv g+ll+f+vgny+ly+yaqk+lP +kkkPvskkk+kreklkqG+++PGe
  Pta013179 26 TAGKGFNPGLIVLLVVVGVLLIFIVGNYVLYMYAQKTLPAKKKKPVSKKKMKREKLKQGISAPGE 90
               456*************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046898.9E-382790IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MDEDFSSQAD VDPSAFASQE RLLTKTAGKG FNPGLIVLLV VVGVLLIFIV GNYVLYMYAQ  60
KTLPAKKKKP VSKKKMKREK LKQGISAPGE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.9181e-152root| shoot| xylem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104121.12e-24DNA-binding protein S1FA1
SwissprotP425532e-16S1FA1_ORYSJ; DNA-binding protein S1FA1
TrEMBLW9SCA32e-24W9SCA3_9R
STRINGSolyc09g007500.2.11e-16(Solanum lycopersicum)